SCOP 1.73: Domain d1q72h1: 1q72 H:1-113

Lineage for d1q72h1 (1q72 H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (43 PDB entries)

8. Domain d1q72h1: 1q72 H:1-113 [96014]
   Other proteins in same PDB: d1q72h2, d1q72l1, d1q72l2
   part of anti-cocaine Fab M82G2
   complexed with coc

Details for d1q72h1

PDB Entry: 1q72, 1.7 Å

PDB Description: Anti-Cocaine Antibody M82G2 Complexed with Cocaine

PDB Compounds: (H:) Fab M82G2, Heavy chain

SCOP Domain Sequences for d1q72h1:

Sequence; same for both SEQRES and ATOM records:

>d1q72h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
a

Timeline for d1q72h1:

• d1q72h1 first appeared in SCOP 1.67
  
• d1q72h1 appears in SCOP 1.71
  
• d1q72h1 appears in SCOP 1.75
  
• d1q72h1 appears in the current release, SCOPe 2.08