Lineage for d1q6pa1 (1q6p A:501-783)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875300Protein Tyrosine phosphatase [52806] (7 species)
  7. 2875301Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 2875549Domain d1q6pa1: 1q6p A:501-783 [95988]
    Other proteins in same PDB: d1q6pa2, d1q6pb2
    complexed with 213, cl

Details for d1q6pa1

PDB Entry: 1q6p (more details), 2.3 Å

PDB Description: the structure of phosphotyrosine phosphatase 1b in complex with compound 6
PDB Compounds: (A:) protein-tyrosine phosphatase, non-receptor type 1

SCOPe Domain Sequences for d1q6pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6pa1 c.45.1.2 (A:501-783) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

SCOPe Domain Coordinates for d1q6pa1:

Click to download the PDB-style file with coordinates for d1q6pa1.
(The format of our PDB-style files is described here.)

Timeline for d1q6pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q6pa2