Lineage for d1q6hb_ (1q6h B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548605Protein Peptidyl-prolyl cis-trans isomerase FkpA [102866] (1 species)
    similar to MIP; contains all-alpha dimerisation subdomain in the N-terminal extension
  7. 2548606Species Escherichia coli [TaxId:562] [102867] (3 PDB entries)
  8. 2548608Domain d1q6hb_: 1q6h B: [95976]

Details for d1q6hb_

PDB Entry: 1q6h (more details), 1.97 Å

PDB Description: Crystal structure of a truncated form of FkpA from Escherichia coli
PDB Compounds: (B:) FKBP-type peptidyl-prolyl cis-trans isomerase fkpA

SCOPe Domain Sequences for d1q6hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6hb_ d.26.1.1 (B:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]}
afknddqksayalgaslgrymenslkeqeklgikldkdqliagvqdafadksklsdqeie
qtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktsstglvyqvveagkge
apkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteglknikkggkiklvi
ppelaygkagvpgippnstlvfdvelldvk

SCOPe Domain Coordinates for d1q6hb_:

Click to download the PDB-style file with coordinates for d1q6hb_.
(The format of our PDB-style files is described here.)

Timeline for d1q6hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q6ha_