SCOPe 2.05: Domain d1q5wa_: 1q5w A:

Lineage for d1q5wa_ (1q5w A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families)
   contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain

5. Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)

6. Protein Npl4 [90215] (1 species)
   a ubiquitin-interacting domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [90216] (2 PDB entries)

8. Domain d1q5wa_: 1q5w A: [95945]
   Other proteins in same PDB: d1q5wb_
   complexed with zn

Details for d1q5wa_

PDB Entry: 1q5w

PDB Description: ubiquitin recognition by npl4 zinc-fingers

PDB Compounds: (A:) homolog of yeast nuclear protein localization 4

SCOPe Domain Sequences for d1q5wa_:

Sequence; same for both SEQRES and ATOM records:

>d1q5wa_ g.41.11.1 (A:) Npl4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gstsamwacqhctfmnqpgtghcemcslprt

Timeline for d1q5wa_:

• d1q5wa_ first appeared in SCOP 1.67
  
• d1q5wa_ appears in SCOPe 2.04
  
• d1q5wa_ is called d1q5wa1 in SCOPe 2.06
  
• d1q5wa_ appears in the current release, SCOPe 2.08, called d1q5wa1