Lineage for d1q5wa_ (1q5w A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966747Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 1966748Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 1966756Protein Npl4 [90215] (1 species)
    a ubiquitin-interacting domain
  7. 1966757Species Norway rat (Rattus norvegicus) [TaxId:10116] [90216] (2 PDB entries)
  8. 1966758Domain d1q5wa_: 1q5w A: [95945]
    Other proteins in same PDB: d1q5wb_
    complexed with zn

Details for d1q5wa_

PDB Entry: 1q5w (more details)

PDB Description: Ubiquitin Recognition by Npl4 Zinc-Fingers
PDB Compounds: (A:) homolog of yeast nuclear protein localization 4

SCOPe Domain Sequences for d1q5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5wa_ g.41.11.1 (A:) Npl4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gstsamwacqhctfmnqpgtghcemcslprt

SCOPe Domain Coordinates for d1q5wa_:

Click to download the PDB-style file with coordinates for d1q5wa_.
(The format of our PDB-style files is described here.)

Timeline for d1q5wa_: