SCOP 1.67: Domain d1q5wa_: 1q5w A:

Lineage for d1q5wa_ (1q5w A:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.12: NZF domain [90213] (1 family)

5. Family g.41.12.1: NZF domain [90214] (1 protein)
   a ubiquitin-interacting domain

6. Protein Npl4 [90215] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [90216] (2 PDB entries)

8. Domain d1q5wa_: 1q5w A: [95945]
   Other proteins in same PDB: d1q5wb_
   complexed with zn

Details for d1q5wa_

PDB Entry: 1q5w

PDB Description: Ubiquitin Recognition by Npl4 Zinc-Fingers

SCOP Domain Sequences for d1q5wa_:

Sequence; same for both SEQRES and ATOM records:

>d1q5wa_ g.41.12.1 (A:) Npl4 {Rat (Rattus norvegicus)}
gstsamwacqhctfmnqpgtghcemcslprt

Timeline for d1q5wa_:

• d1q5wa_ is new in SCOP 1.67
  
• d1q5wa_ appears in SCOP 1.69
  
• d1q5wa_ appears in the current release, SCOPe 2.07, called d1q5wa1