Lineage for d1q5rn_ (1q5r N:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 420035Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 420238Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 420334Species Rhodococcus erythropolis [103313] (2 PDB entries)
  8. 420348Domain d1q5rn_: 1q5r N: [95931]
    Other proteins in same PDB: d1q5ra_, d1q5rb_, d1q5rc_, d1q5rd_, d1q5re_, d1q5rf_, d1q5rg_
    contains unprocessed pro-peptides
    mutant

Details for d1q5rn_

PDB Entry: 1q5r (more details), 3.1 Å

PDB Description: The Rhodococcus 20S proteasome with unprocessed pro-peptides

SCOP Domain Sequences for d1q5rn_:

Sequence, based on SEQRES records: (download)

>d1q5rn_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis}
lsfgsnlssftdylrghapellpenrighrshstrggdgmesgdlaphgttivaltykgg
vllagdrratqgnliasrdveavyvtdeysaagiagtagiaielvrlfavelehyekieg
vpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragrivsydvvggrye
eragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsatggpdltrgiy
ptavtitqagavhvseettselarriva

Sequence, based on observed residues (ATOM records): (download)

>d1q5rn_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis}
lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
ttselarriva

SCOP Domain Coordinates for d1q5rn_:

Click to download the PDB-style file with coordinates for d1q5rn_.
(The format of our PDB-style files is described here.)

Timeline for d1q5rn_: