Lineage for d1q5rk_ (1q5r K:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876390Species Rhodococcus erythropolis [TaxId:1833] [103313] (3 PDB entries)
  8. 876401Domain d1q5rk_: 1q5r K: [95928]
    Other proteins in same PDB: d1q5ra_, d1q5rb_, d1q5rc_, d1q5rd_, d1q5re_, d1q5rf_, d1q5rg_
    contains unprocessed pro-peptides

Details for d1q5rk_

PDB Entry: 1q5r (more details), 3.1 Å

PDB Description: The Rhodococcus 20S proteasome with unprocessed pro-peptides
PDB Compounds: (K:) proteasome beta-type subunit 1

SCOP Domain Sequences for d1q5rk_:

Sequence, based on SEQRES records: (download)

>d1q5rk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
lsfgsnlssftdylrghapellpenrighrshstrggdgmesgdlaphgttivaltykgg
vllagdrratqgnliasrdveavyvtdeysaagiagtagiaielvrlfavelehyekieg
vpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragrivsydvvggrye
eragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsatggpdltrgiy
ptavtitqagavhvseettselarriva

Sequence, based on observed residues (ATOM records): (download)

>d1q5rk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
lsfgsnlssftdylrghapellpenrdlaphgttivaltykggvllagdrratqgnlias
rdveavyvtdeysaagiagtagiaielvrlfavelehyekiegvpltfdgkanrlasmvr
gnlgaamqglavvpllvgydldaddesragrivsydvvggryeeragyhavgsgslfaks
alkkiyspdsdeetalraaieslydaadddsatggpdltrgiyptavtitqagavhvsee
ttselarriva

SCOP Domain Coordinates for d1q5rk_:

Click to download the PDB-style file with coordinates for d1q5rk_.
(The format of our PDB-style files is described here.)

Timeline for d1q5rk_: