Lineage for d1q5rd_ (1q5r D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2550625Species Rhodococcus erythropolis [TaxId:1833] [103314] (3 PDB entries)
  8. 2550636Domain d1q5rd_: 1q5r D: [95921]
    Other proteins in same PDB: d1q5rh_, d1q5ri_, d1q5rj_, d1q5rk_, d1q5rl_, d1q5rm_, d1q5rn_

Details for d1q5rd_

PDB Entry: 1q5r (more details), 3.1 Å

PDB Description: The Rhodococcus 20S proteasome with unprocessed pro-peptides
PDB Compounds: (D:) proteasome alpha-type subunit 1

SCOPe Domain Sequences for d1q5rd_:

Sequence, based on SEQRES records: (download)

>d1q5rd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpae

Sequence, based on observed residues (ATOM records): (download)

>d1q5rd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggvdvaslevavldqsrprrafrriagtaleqlvpae

SCOPe Domain Coordinates for d1q5rd_:

Click to download the PDB-style file with coordinates for d1q5rd_.
(The format of our PDB-style files is described here.)

Timeline for d1q5rd_: