Lineage for d1q5ql_ (1q5q L:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612721Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 612722Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 612861Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 613064Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 613160Species Rhodococcus erythropolis [103313] (2 PDB entries)
  8. 613165Domain d1q5ql_: 1q5q L: [95915]
    Other proteins in same PDB: d1q5qa_, d1q5qb_, d1q5qc_, d1q5qd_, d1q5qe_, d1q5qf_, d1q5qg_

Details for d1q5ql_

PDB Entry: 1q5q (more details), 2.6 Å

PDB Description: The Rhodococcus 20S proteasome

SCOP Domain Sequences for d1q5ql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5ql_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis}
ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
tggpdltrgiyptavtitqagavhvseettselarrivaerteq

SCOP Domain Coordinates for d1q5ql_:

Click to download the PDB-style file with coordinates for d1q5ql_.
(The format of our PDB-style files is described here.)

Timeline for d1q5ql_: