Lineage for d1q5qe_ (1q5q E:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 420035Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 420120Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 420223Species Rhodococcus erythropolis [103314] (2 PDB entries)
  8. 420228Domain d1q5qe_: 1q5q E: [95908]
    Other proteins in same PDB: d1q5qh_, d1q5qi_, d1q5qj_, d1q5qk_, d1q5ql_, d1q5qm_, d1q5qn_

Details for d1q5qe_

PDB Entry: 1q5q (more details), 2.6 Å

PDB Description: The Rhodococcus 20S proteasome

SCOP Domain Sequences for d1q5qe_:

Sequence, based on SEQRES records: (download)

>d1q5qe_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpae

Sequence, based on observed residues (ATOM records): (download)

>d1q5qe_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggvdvaslevavldqsrprrafrriagtaleqlvpae

SCOP Domain Coordinates for d1q5qe_:

Click to download the PDB-style file with coordinates for d1q5qe_.
(The format of our PDB-style files is described here.)

Timeline for d1q5qe_: