SCOP 1.75: Domain d1q5hb_: 1q5h B:

Lineage for d1q5hb_ (1q5h B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)

8. Domain d1q5hb_: 1q5h B: [95894]

Details for d1q5hb_

PDB Entry: 1q5h, 2 Å

PDB Description: Human dUTP Pyrophosphatase complex with dUDP

PDB Compounds: (B:) dUTP pyrophosphatase

SCOP Domain Sequences for d1q5hb_:

Sequence; same for both SEQRES and ATOM records:

>d1q5hb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfg

Timeline for d1q5hb_:

• d1q5hb_ first appeared in SCOP 1.67
  
• d1q5hb_ appears in SCOP 1.73
  
• d1q5hb_ appears in SCOPe 2.01
  
• d1q5hb_ appears in the current release, SCOPe 2.08