Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Pf GST [102442] (1 species) cannot be assigned to any of the known GST classes |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (5 PDB entries) |
Domain d1q4jb2: 1q4j B:3-85 [95796] Other proteins in same PDB: d1q4ja1, d1q4jb1 complexed with gtx |
PDB Entry: 1q4j (more details), 2.2 Å
SCOPe Domain Sequences for d1q4jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4jb2 c.47.1.5 (B:3-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil qigdlilaqsqaivrylskkyni
Timeline for d1q4jb2: