SCOP 1.67: Domain d1q4jb1: 1q4j B:86-211

Lineage for d1q4jb1 (1q4j B:86-211)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Pf GST [101210] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (3 PDB entries)

8. Domain d1q4jb1: 1q4j B:86-211 [95795]
   Other proteins in same PDB: d1q4ja2, d1q4jb2
   complexed with gtx

Details for d1q4jb1

PDB Entry: 1q4j, 2.2 Å

PDB Description: Crystal Structure of Pf-GST1 with its inhibitor s-hexyl-GSH

SCOP Domain Sequences for d1q4jb1:

Sequence; same for both SEQRES and ATOM records:

>d1q4jb1 a.45.1.1 (B:86-211) Pf GST {Malarial parasite (Plasmodium falciparum)}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

Timeline for d1q4jb1:

• d1q4jb1 is new in SCOP 1.67
  
• d1q4jb1 appears in SCOP 1.69
  
• d1q4jb1 appears in the current release, SCOPe 2.08