SCOP 1.75: Domain d1q4ga2: 1q4g A:32-73

Lineage for d1q4ga2 (1q4g A:32-73)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries)
   Uniprot P05979 32-584

8. Domain d1q4ga2: 1q4g A:32-73 [95790]
   Other proteins in same PDB: d1q4ga1, d1q4gb1

Details for d1q4ga2

PDB Entry: 1q4g, 2 Å

PDB Description: 2.0 angstrom crystal structure of ovine prostaglandin h2 synthase-1, in complex with alpha-methyl-4-biphenylacetic acid

PDB Compounds: (A:) Prostaglandin G/H synthase 1

SCOP Domain Sequences for d1q4ga2:

Sequence; same for both SEQRES and ATOM records:

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1q4ga2:

• d1q4ga2 first appeared in SCOP 1.67
  
• d1q4ga2 appears in SCOP 1.73
  
• d1q4ga2 appears in SCOPe 2.01
  
• d1q4ga2 appears in the current release, SCOPe 2.08