SCOP 1.75: Domain d1q3uf2: 1q3u F:130-341

Lineage for d1q3uf2 (1q3u F:130-341)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1q3uf2: 1q3u F:130-341 [95759]
   Other proteins in same PDB: d1q3ua1, d1q3ub1, d1q3ue1, d1q3uf1
   complexed with iod, mg, ump

Details for d1q3uf2

PDB Entry: 1q3u, 2.9 Å

PDB Description: Crystal structure of a wild-type Cre recombinase-loxP synapse: pre-cleavage complex

PDB Compounds: (F:) cre recombinase

SCOP Domain Sequences for d1q3uf2:

Sequence; same for both SEQRES and ATOM records:

>d1q3uf2 d.163.1.1 (F:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d1q3uf2:

• d1q3uf2 first appeared in SCOP 1.67
  
• d1q3uf2 appears in SCOP 1.73
  
• d1q3uf2 appears in SCOPe 2.01
  
• d1q3uf2 appears in the current release, SCOPe 2.08