Lineage for d1q3se1 (1q3s E:10-145,E:406-526)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098640Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 1098641Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 1098797Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)
  6. 1098798Protein Thermosome, E domain [48597] (3 species)
  7. 1098799Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [101457] (4 PDB entries)
  8. 1098816Domain d1q3se1: 1q3s E:10-145,E:406-526 [95740]
    Other proteins in same PDB: d1q3sa2, d1q3sa3, d1q3sb2, d1q3sb3, d1q3sc2, d1q3sc3, d1q3sd2, d1q3sd3, d1q3se2, d1q3se3, d1q3sf2, d1q3sf3, d1q3sg2, d1q3sg3, d1q3sh2, d1q3sh3
    complexed with adp, mg

Details for d1q3se1

PDB Entry: 1q3s (more details), 3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (formiii crystal complexed with adp)
PDB Compounds: (E:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q3se1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3se1 a.129.1.2 (E:10-145,E:406-526) Thermosome, E domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
laaekaqeildeiairXavlpaggapeielairldeyakqvggkealaienfadalkiip
ktlaenagldtvemlvkvisehknrglgigidvfegkpadmlekgiieplrvkkqaiksa
seaaimilriddviaaka

SCOPe Domain Coordinates for d1q3se1:

Click to download the PDB-style file with coordinates for d1q3se1.
(The format of our PDB-style files is described here.)

Timeline for d1q3se1: