Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species) CMGC group; GSK3 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [69824] (43 PDB entries) Uniprot P49841 35-383 ! Uniprot P49841 35-384 |
Domain d1q3da_: 1q3d A: [95667] complexed with stu |
PDB Entry: 1q3d (more details), 2.2 Å
SCOPe Domain Sequences for d1q3da_:
Sequence, based on SEQRES records: (download)
>d1q3da_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
>d1q3da_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq iremnpfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp nvklpngrdtpalfnfttqelssnpplatilipphariq
Timeline for d1q3da_: