Lineage for d1q3da_ (1q3d A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512316Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 512317Species Human (Homo sapiens) [TaxId:9606] [69824] (13 PDB entries)
  8. 512340Domain d1q3da_: 1q3d A: [95667]

Details for d1q3da_

PDB Entry: 1q3d (more details), 2.2 Å

PDB Description: GSK-3 Beta complexed with Staurosporine

SCOP Domain Sequences for d1q3da_:

Sequence, based on SEQRES records: (download)

>d1q3da_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq

Sequence, based on observed residues (ATOM records): (download)

>d1q3da_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
iremnpfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
nvklpngrdtpalfnfttqelssnpplatilipphariq

SCOP Domain Coordinates for d1q3da_:

Click to download the PDB-style file with coordinates for d1q3da_.
(The format of our PDB-style files is described here.)

Timeline for d1q3da_: