SCOP 1.71: Domain d1q24a_: 1q24 A:

Lineage for d1q24a_ (1q24 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (12 PDB entries)

8. Domain d1q24a_: 1q24 A: [95618]
   double mutant model of PKB; complexed with peptide inhibitor, chain B

Details for d1q24a_

PDB Entry: 1q24, 2.6 Å

PDB Description: pka double mutant model of pkb in complex with mgatp

SCOP Domain Sequences for d1q24a_:

Sequence; same for both SEQRES and ATOM records:

>d1q24a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus)}
svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyapggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1q24a_:

• d1q24a_ first appeared in SCOP 1.67
  
• d1q24a_ appears in SCOP 1.69
  
• d1q24a_ appears in SCOP 1.73
  
• d1q24a_ appears in the current release, SCOPe 2.08