Lineage for d1q1wb2 (1q1w B:115-247)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 388822Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 388823Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 389137Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 389306Protein Putidaredoxin reductase [102185] (1 species)
  7. 389307Species Pseudomonas putida [TaxId:303] [102186] (2 PDB entries)
  8. 389315Domain d1q1wb2: 1q1w B:115-247 [95613]
    Other proteins in same PDB: d1q1wa3, d1q1wb3
    complexed with fad

Details for d1q1wb2

PDB Entry: 1q1w (more details), 2.6 Å

PDB Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida

SCOP Domain Sequences for d1q1wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1wb2 c.3.1.5 (B:115-247) Putidaredoxin reductase {Pseudomonas putida}
rplpvasgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmh
vtlldtaarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedg
trlpadlviagig

SCOP Domain Coordinates for d1q1wb2:

Click to download the PDB-style file with coordinates for d1q1wb2.
(The format of our PDB-style files is described here.)

Timeline for d1q1wb2: