Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Putidaredoxin reductase [102185] (1 species) |
Species Pseudomonas putida [TaxId:303] [102186] (2 PDB entries) |
Domain d1q1wb2: 1q1w B:115-247 [95613] Other proteins in same PDB: d1q1wa3, d1q1wb3 complexed with fad |
PDB Entry: 1q1w (more details), 2.6 Å
SCOP Domain Sequences for d1q1wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1wb2 c.3.1.5 (B:115-247) Putidaredoxin reductase {Pseudomonas putida} rplpvasgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmh vtlldtaarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedg trlpadlviagig
Timeline for d1q1wb2: