SCOP 1.75: Domain d1q1jm2: 1q1j M:109-213

Lineage for d1q1jm2 (1q1j M:109-213)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d1q1jm2: 1q1j M:109-213 [95588]
   Other proteins in same PDB: d1q1jh1, d1q1jh2, d1q1ji1, d1q1ji2, d1q1jl1, d1q1jm1
   part of anti HIV-1 Fab 447-52d

Details for d1q1jm2

PDB Entry: 1q1j, 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide

PDB Compounds: (M:) Fab 447-52D, light chain

SCOP Domain Sequences for d1q1jm2:

Sequence; same for both SEQRES and ATOM records:

>d1q1jm2 b.1.1.2 (M:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d1q1jm2:

• d1q1jm2 first appeared in SCOP 1.67
  
• d1q1jm2 appears in SCOP 1.73
  
• d1q1jm2 appears in SCOPe 2.01
  
• d1q1jm2 appears in the current release, SCOPe 2.08