SCOP 1.71: Domain d1q1jm1: 1q1j M:1-108

Lineage for d1q1jm1 (1q1j M:1-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (9 PDB entries)

8. Domain d1q1jm1: 1q1j M:1-108 [95587]
   Other proteins in same PDB: d1q1jh1, d1q1jh2, d1q1ji1, d1q1ji2, d1q1jl2, d1q1jm2
   part of anti HIV-1 Fab 447-52d

Details for d1q1jm1

PDB Entry: 1q1j, 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide

SCOP Domain Sequences for d1q1jm1:

Sequence; same for both SEQRES and ATOM records:

>d1q1jm1 b.1.1.1 (M:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2}
qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsq

Timeline for d1q1jm1:

• d1q1jm1 first appeared in SCOP 1.67
  
• d1q1jm1 appears in SCOP 1.69
  
• d1q1jm1 appears in SCOP 1.73
  
• d1q1jm1 appears in the current release, SCOPe 2.08