SCOP 1.67: Domain d1q1ji2: 1q1j I:114-227

Lineage for d1q1ji2 (1q1j I:114-227)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1q1ji2: 1q1j I:114-227 [95584]
   Other proteins in same PDB: d1q1jh1, d1q1ji1, d1q1jl1, d1q1jl2, d1q1jm1, d1q1jm2
   part of anti HIV-1 Fab 447-52d

Details for d1q1ji2

PDB Entry: 1q1j, 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide

SCOP Domain Sequences for d1q1ji2:

Sequence; same for both SEQRES and ATOM records:

>d1q1ji2 b.1.1.2 (I:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel

Timeline for d1q1ji2:

• d1q1ji2 is new in SCOP 1.67
  
• d1q1ji2 appears in SCOP 1.69
  
• d1q1ji2 appears in the current release, SCOPe 2.08