SCOPe 2.05: Domain d1q1ji1: 1q1j I:1-113

Lineage for d1q1ji1 (1q1j I:1-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [101505] (4 PDB entries)

8. Domain d1q1ji1: 1q1j I:1-113 [95583]
   Other proteins in same PDB: d1q1jh2, d1q1ji2, d1q1jl1, d1q1jl2, d1q1jm1, d1q1jm2
   part of anti HIV-1 Fab 447-52d

Details for d1q1ji1

PDB Entry: 1q1j, 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide

PDB Compounds: (I:) Fab 447-52D, heavy chain

SCOPe Domain Sequences for d1q1ji1:

Sequence; same for both SEQRES and ATOM records:

>d1q1ji1 b.1.1.1 (I:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
wgkgttvtvss

Timeline for d1q1ji1:

• d1q1ji1 first appeared in SCOP 1.67
  
• d1q1ji1 appears in SCOPe 2.04
  
• d1q1ji1 appears in SCOPe 2.06
  
• d1q1ji1 appears in the current release, SCOPe 2.08