SCOP 1.67: Domain d1q1ea2: 1q1e A:4-235

Lineage for d1q1ea2 (1q1e A:4-235)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (16 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Escherichia coli [TaxId:562] [102380] (3 PDB entries)

8. Domain d1q1ea2: 1q1e A:4-235 [95571]
   Other proteins in same PDB: d1q1ea1, d1q1eb1

Details for d1q1ea2

PDB Entry: 1q1e, 2.9 Å

PDB Description: The ATPase component of E. coli maltose transporter (MalK) in the nucleotide-free form

SCOP Domain Sequences for d1q1ea2:

Sequence; same for both SEQRES and ATOM records:

>d1q1ea2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli}
vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig
ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql
ahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrl
grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Timeline for d1q1ea2:

• d1q1ea2 is new in SCOP 1.67
  
• d1q1ea2 appears in SCOP 1.69
  
• d1q1ea2 appears in the current release, SCOPe 2.08