Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (16 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
Species Escherichia coli [TaxId:562] [102380] (3 PDB entries) |
Domain d1q1bb2: 1q1b B:4-235 [95565] Other proteins in same PDB: d1q1ba1, d1q1bb1, d1q1bc1, d1q1bd1 |
PDB Entry: 1q1b (more details), 2.8 Å
SCOP Domain Sequences for d1q1bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1bb2 c.37.1.12 (B:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli} vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql ahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrl grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig
Timeline for d1q1bb2: