Lineage for d1q19a1 (1q19 A:206-501)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392401Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 392402Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 392444Protein beta-Lactam synthetase [69456] (2 species)
    Asparagine synthetase B homologue
  7. 392445Species Pectobacterium carotovorum [TaxId:554] [102263] (2 PDB entries)
    carbapenam synthetase CarA
  8. 392450Domain d1q19a1: 1q19 A:206-501 [95553]
    Other proteins in same PDB: d1q19a2, d1q19b2, d1q19c2, d1q19d2

Details for d1q19a1

PDB Entry: 1q19 (more details), 2.4 Å

PDB Description: Carbapenam Synthetase

SCOP Domain Sequences for d1q19a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q19a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum}
pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl
ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs
glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg
ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrkkig
ihegssvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik

SCOP Domain Coordinates for d1q19a1:

Click to download the PDB-style file with coordinates for d1q19a1.
(The format of our PDB-style files is described here.)

Timeline for d1q19a1: