SCOP 1.67: Domain d1q10b_: 1q10 B:

Lineage for d1q10b_ (1q10 B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (24 PDB entries)

8. Domain d1q10b_: 1q10 B: [95527]
   segment-swapped dimeric mutant

Details for d1q10b_

PDB Entry: 1q10

PDB Description: ensemble of 40 structures of the dimeric mutant of the b1 domain of streptococcal protein g

SCOP Domain Sequences for d1q10b_:

Sequence; same for both SEQRES and ATOM records:

>d1q10b_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mqykvilngktlkgettteavdaataekvvkqffndngvdgewtyddatktftvte

Timeline for d1q10b_:

• d1q10b_ is new in SCOP 1.67
  
• d1q10b_ appears in SCOP 1.69
  
• d1q10b_ appears in the current release, SCOPe 2.08