SCOPe 2.06: Domain d1q10a_: 1q10 A:

Lineage for d1q10a_ (1q10 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries)

8. Domain d1q10a_: 1q10 A: [95526]
   segment-swapped dimeric mutant
   mutant

Details for d1q10a_

PDB Entry: 1q10

PDB Description: ensemble of 40 structures of the dimeric mutant of the b1 domain of streptococcal protein g

PDB Compounds: (A:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1q10a_:

Sequence; same for both SEQRES and ATOM records:

>d1q10a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaataekvvkqffndngvdgewtyddatktftvte

Timeline for d1q10a_:

• d1q10a_ first appeared in SCOP 1.67
  
• d1q10a_ appears in SCOPe 2.05
  
• d1q10a_ appears in SCOPe 2.07
  
• d1q10a_ appears in the current release, SCOPe 2.08