SCOPe 2.04: Domain d1q0yl2: 1q0y L:108-212

Lineage for d1q0yl2 (1q0y L:108-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d1q0yl2: 1q0y L:108-212 [95524]
   Other proteins in same PDB: d1q0yh1, d1q0yh2, d1q0yl1
   part of anti-morphine Fab 9b1
   complexed with moi, so4

Details for d1q0yl2

PDB Entry: 1q0y, 2 Å

PDB Description: Anti-Morphine Antibody 9B1 Complexed with Morphine

PDB Compounds: (L:) Fab 9B1, light chain

SCOPe Domain Sequences for d1q0yl2:

Sequence; same for both SEQRES and ATOM records:

>d1q0yl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkssptvtlfppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskq
snnkymassyltltarawerhssyscqvtheghssnktlsra

Timeline for d1q0yl2:

• d1q0yl2 first appeared in SCOP 1.67
  
• d1q0yl2 appears in SCOPe 2.03
  
• d1q0yl2 appears in SCOPe 2.05
  
• d1q0yl2 appears in the current release, SCOPe 2.08