Lineage for d1q0yl2 (1q0y L:108-212)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656556Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 656560Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries)
  8. 656568Domain d1q0yl2: 1q0y L:108-212 [95524]
    Other proteins in same PDB: d1q0yh1, d1q0yh2, d1q0yl1
    part of anti-morphine Fab 9b1
    complexed with moi, so4

Details for d1q0yl2

PDB Entry: 1q0y (more details), 2 Å

PDB Description: Anti-Morphine Antibody 9B1 Complexed with Morphine
PDB Compounds: (L:) Fab 9B1, light chain

SCOP Domain Sequences for d1q0yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0yl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkssptvtlfppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskq
snnkymassyltltarawerhssyscqvtheghssnktlsra

SCOP Domain Coordinates for d1q0yl2:

Click to download the PDB-style file with coordinates for d1q0yl2.
(The format of our PDB-style files is described here.)

Timeline for d1q0yl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q0yl1