![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries) |
![]() | Domain d1q0yl2: 1q0y L:108-212 [95524] Other proteins in same PDB: d1q0yh1, d1q0yh2, d1q0yl1 part of anti-morphine Fab 9b1 complexed with moi, so4 |
PDB Entry: 1q0y (more details), 2 Å
SCOP Domain Sequences for d1q0yl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0yl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkssptvtlfppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskq snnkymassyltltarawerhssyscqvtheghssnktlsra
Timeline for d1q0yl2: