SCOP 1.75: Domain d1q0yl1: 1q0y L:1-107

Lineage for d1q0yl1 (1q0y L:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)

8. Domain d1q0yl1: 1q0y L:1-107 [95523]
   Other proteins in same PDB: d1q0yh1, d1q0yh2, d1q0yl2
   part of anti-morphine Fab 9b1
   complexed with moi, so4

Details for d1q0yl1

PDB Entry: 1q0y, 2 Å

PDB Description: Anti-Morphine Antibody 9B1 Complexed with Morphine

PDB Compounds: (L:) Fab 9B1, light chain

SCOP Domain Sequences for d1q0yl1:

Sequence; same for both SEQRES and ATOM records:

>d1q0yl1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlg

Timeline for d1q0yl1:

• d1q0yl1 first appeared in SCOP 1.67
  
• d1q0yl1 appears in SCOP 1.73
  
• d1q0yl1 appears in SCOPe 2.01
  
• d1q0yl1 appears in the current release, SCOPe 2.08