Lineage for d1q0yl1 (1q0y L:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364057Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 364136Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)
  8. 364141Domain d1q0yl1: 1q0y L:1-107 [95523]
    Other proteins in same PDB: d1q0yh1, d1q0yh2, d1q0yl2
    part of anti-morphine Fab 9b1
    complexed with moi, so4

Details for d1q0yl1

PDB Entry: 1q0y (more details), 2 Å

PDB Description: Anti-Morphine Antibody 9B1 Complexed with Morphine

SCOP Domain Sequences for d1q0yl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0yl1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlg

SCOP Domain Coordinates for d1q0yl1:

Click to download the PDB-style file with coordinates for d1q0yl1.
(The format of our PDB-style files is described here.)

Timeline for d1q0yl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q0yl2