Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1q0yh2: 1q0y H:114-228 [95522] Other proteins in same PDB: d1q0yh1, d1q0yl1, d1q0yl2 part of anti-morfine Fab 9b1 complexed with moi, so4 |
PDB Entry: 1q0y (more details), 2 Å
SCOP Domain Sequences for d1q0yh2:
Sequence, based on SEQRES records: (download)
>d1q0yh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} asttppsvyplapggxxxxxxsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavla adlytlsssvtvsasswpgqsvtcnvahpasstkvdkkiaps
>d1q0yh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} asttppsvyplapggsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaadlytl sssvtvsasswpgqsvtcnvahpasstkvdkkiaps
Timeline for d1q0yh2: