| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
| Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
| Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries) |
| Domain d1q0xl1: 1q0x L:1-107 [95519] Other proteins in same PDB: d1q0xh1, d1q0xh2, d1q0xl2 part of anti-morphine Fab 9b1 complexed with pg4, so4 |
PDB Entry: 1q0x (more details), 1.6 Å
SCOP Domain Sequences for d1q0xl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0xl1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlg
Timeline for d1q0xl1: