Lineage for d1q0xh2 (1q0x H:114-228)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453408Domain d1q0xh2: 1q0x H:114-228 [95518]
    Other proteins in same PDB: d1q0xh1, d1q0xl1, d1q0xl2
    part of anti-morfine Fab 9b1

Details for d1q0xh2

PDB Entry: 1q0x (more details), 1.6 Å

PDB Description: Anti-morphine Antibody 9B1 Unliganded Form

SCOP Domain Sequences for d1q0xh2:

Sequence, based on SEQRES records: (download)

>d1q0xh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
asttppsvyplapgghhhhhhsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavla
adlytlsssvtvsasswpgqsvtcnvahpasstkvdkkiaps

Sequence, based on observed residues (ATOM records): (download)

>d1q0xh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
asttppsvyplapggsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaadlytl
sssvtvsasswpgqsvtcnvahpasstkvdkkiaps

SCOP Domain Coordinates for d1q0xh2:

Click to download the PDB-style file with coordinates for d1q0xh2.
(The format of our PDB-style files is described here.)

Timeline for d1q0xh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q0xh1