Lineage for d1q0xh1 (1q0x H:1-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756146Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1756156Domain d1q0xh1: 1q0x H:1-113 [95517]
    Other proteins in same PDB: d1q0xh2, d1q0xl1, d1q0xl2
    part of anti-morfine Fab 9b1
    complexed with pg4, so4

Details for d1q0xh1

PDB Entry: 1q0x (more details), 1.6 Å

PDB Description: Anti-morphine Antibody 9B1 Unliganded Form
PDB Compounds: (H:) Fab 9B1, heavy chain

SCOPe Domain Sequences for d1q0xh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvss

SCOPe Domain Coordinates for d1q0xh1:

Click to download the PDB-style file with coordinates for d1q0xh1.
(The format of our PDB-style files is described here.)

Timeline for d1q0xh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q0xh2