SCOP 1.67: Domain d1q0xh1: 1q0x H:1-113

Lineage for d1q0xh1 (1q0x H:1-113)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)

8. Domain d1q0xh1: 1q0x H:1-113 [95517]
   Other proteins in same PDB: d1q0xh2, d1q0xl1, d1q0xl2
   part of anti-morfine Fab 9b1
   complexed with pg4, so4

Details for d1q0xh1

PDB Entry: 1q0x, 1.6 Å

PDB Description: Anti-morphine Antibody 9B1 Unliganded Form

SCOP Domain Sequences for d1q0xh1:

Sequence; same for both SEQRES and ATOM records:

>d1q0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvss

Timeline for d1q0xh1:

• d1q0xh1 is new in SCOP 1.67
  
• d1q0xh1 appears in SCOP 1.69
  
• d1q0xh1 appears in the current release, SCOPe 2.08