SCOPe 2.06: Domain d1q02a1: 1q02 A:3-52

Lineage for d1q02a1 (1q02 A:3-52)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
   ubiquitin-binding protein p62

7. Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries)

8. Domain d1q02a1: 1q02 A:3-52 [95490]
   Other proteins in same PDB: d1q02a2

Details for d1q02a1

PDB Entry: 1q02

PDB Description: nmr structure of the uba domain of p62 (sqstm1)

PDB Compounds: (A:) sequestosome 1

SCOPe Domain Sequences for d1q02a1:

Sequence; same for both SEQRES and ATOM records:

>d1q02a1 a.5.2.1 (A:3-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
ppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

Timeline for d1q02a1:

• d1q02a1 first appeared in SCOP 1.67, called d1q02a_
  
• d1q02a1 was called d1q02a_ in SCOPe 2.05
  
• d1q02a1 appears in SCOPe 2.07
  
• d1q02a1 appears in the current release, SCOPe 2.08