Lineage for d1pzyc_ (1pzy C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 595970Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 596002Species Mouse (Mus musculus) [TaxId:10090] [69628] (9 PDB entries)
  8. 596016Domain d1pzyc_: 1pzy C: [95488]
    Other proteins in same PDB: d1pzyb_, d1pzyd_
    complexed with ca, mn, nag, udp; mutant

Details for d1pzyc_

PDB Entry: 1pzy (more details), 2.3 Å

PDB Description: w314a-beta1,4-galactosyltransferase-i complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese

SCOP Domain Sequences for d1pzyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzyc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1pzyc_:

Click to download the PDB-style file with coordinates for d1pzyc_.
(The format of our PDB-style files is described here.)

Timeline for d1pzyc_: