Lineage for d1pzoa_ (1pzo A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 423760Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 423761Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 423762Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (10 proteins)
  6. 423845Protein beta-Lactamase, class A [56606] (15 species)
  7. 423860Species Escherichia coli, TEM-1 [TaxId:562] [56607] (28 PDB entries)
  8. 423881Domain d1pzoa_: 1pzo A: [95464]
    complexed with cbt; mutant

Details for d1pzoa_

PDB Entry: 1pzo (more details), 1.9 Å

PDB Description: TEM-1 Beta-Lactamase in Complex with a Novel, Core-Disrupting, Allosteric Inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1pzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzoa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1pzoa_:

Click to download the PDB-style file with coordinates for d1pzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1pzoa_: