Lineage for d1pzhc1 (1pzh C:14-163)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478258Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 478281Protein Lactate dehydrogenase [51859] (13 species)
  7. 478348Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries)
  8. 478356Domain d1pzhc1: 1pzh C:14-163 [95437]
    Other proteins in same PDB: d1pzha2, d1pzhb2, d1pzhc2, d1pzhd2

Details for d1pzhc1

PDB Entry: 1pzh (more details), 1.9 Å

PDB Description: T.gondii LDH1 ternary complex with NAD and oxalate

SCOP Domain Sequences for d1pzhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzhc1 c.2.1.5 (C:14-163) Lactate dehydrogenase {Toxoplasma gondii}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOP Domain Coordinates for d1pzhc1:

Click to download the PDB-style file with coordinates for d1pzhc1.
(The format of our PDB-style files is described here.)

Timeline for d1pzhc1: