SCOP 1.67: Domain d1pzgb1: 1pzg B:14-163

Lineage for d1pzgb1 (1pzg B:14-163)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)

6. Protein Lactate dehydrogenase [51859] (13 species)

7. Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries)

8. Domain d1pzgb1: 1pzg B:14-163 [95427]
   Other proteins in same PDB: d1pzga2, d1pzgb2, d1pzgc2, d1pzgd2

Details for d1pzgb1

PDB Entry: 1pzg, 1.6 Å

PDB Description: T.gondii LDH1 complexed with APAD and sulfate at 1.6 Angstroms

SCOP Domain Sequences for d1pzgb1:

Sequence; same for both SEQRES and ATOM records:

>d1pzgb1 c.2.1.5 (B:14-163) Lactate dehydrogenase {Toxoplasma gondii}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

Timeline for d1pzgb1:

• d1pzgb1 is new in SCOP 1.67
  
• d1pzgb1 appears in SCOP 1.69
  
• d1pzgb1 appears in the current release, SCOPe 2.08