Lineage for d1pzfd2 (1pzf D:164-332)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047016Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1047017Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1047018Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1047025Protein Lactate dehydrogenase [56339] (15 species)
  7. 1047112Species Toxoplasma gondii [TaxId:5811] [103326] (4 PDB entries)
  8. 1047125Domain d1pzfd2: 1pzf D:164-332 [95424]
    Other proteins in same PDB: d1pzfa1, d1pzfb1, d1pzfc1, d1pzfd1
    complexed with a3d, oxl

Details for d1pzfd2

PDB Entry: 1pzf (more details), 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate
PDB Compounds: (D:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzfd2 d.162.1.1 (D:164-332) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalq

SCOPe Domain Coordinates for d1pzfd2:

Click to download the PDB-style file with coordinates for d1pzfd2.
(The format of our PDB-style files is described here.)

Timeline for d1pzfd2: