Lineage for d1pzfc1 (1pzf C:14-163)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2453094Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries)
  8. 2453106Domain d1pzfc1: 1pzf C:14-163 [95421]
    Other proteins in same PDB: d1pzfa2, d1pzfa3, d1pzfb2, d1pzfb3, d1pzfc2, d1pzfd2
    complexed with a3d, oxl

Details for d1pzfc1

PDB Entry: 1pzf (more details), 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate
PDB Compounds: (C:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzfc1 c.2.1.5 (C:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOPe Domain Coordinates for d1pzfc1:

Click to download the PDB-style file with coordinates for d1pzfc1.
(The format of our PDB-style files is described here.)

Timeline for d1pzfc1: