Lineage for d1pzfb1 (1pzf B:14-163)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478258Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 478281Protein Lactate dehydrogenase [51859] (13 species)
  7. 478348Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries)
  8. 478359Domain d1pzfb1: 1pzf B:14-163 [95419]
    Other proteins in same PDB: d1pzfa2, d1pzfb2, d1pzfc2, d1pzfd2

Details for d1pzfb1

PDB Entry: 1pzf (more details), 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate

SCOP Domain Sequences for d1pzfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzfb1 c.2.1.5 (B:14-163) Lactate dehydrogenase {Toxoplasma gondii}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOP Domain Coordinates for d1pzfb1:

Click to download the PDB-style file with coordinates for d1pzfb1.
(The format of our PDB-style files is described here.)

Timeline for d1pzfb1: