SCOP 1.73: Domain d1pz3b1: 1pz3 B:5-17,B:385-501

Lineage for d1pz3b1 (1pz3 B:5-17,B:385-501)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Alpha-l-arabinofuranosidase [101924] (2 species)
   glycosyl hydrolase family 51

7. Species Bacillus stearothermophilus [TaxId:1422] [101925] (4 PDB entries)

8. Domain d1pz3b1: 1pz3 B:5-17,B:385-501 [95398]
   Other proteins in same PDB: d1pz3a2, d1pz3b2
   complexed with gol

Details for d1pz3b1

PDB Entry: 1pz3, 1.75 Å

PDB Description: crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6

PDB Compounds: (B:) alpha-l-arabinofuranosidase

SCOP Domain Sequences for d1pz3b1:

Sequence; same for both SEQRES and ATOM records:

>d1pz3b1 b.71.1.2 (B:5-17,B:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]}
katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm
edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp
klswnvirlgk

Timeline for d1pz3b1:

• d1pz3b1 first appeared in SCOP 1.67
  
• d1pz3b1 appears in SCOP 1.71
  
• d1pz3b1 appears in SCOP 1.75
  
• d1pz3b1 appears in the current release, SCOPe 2.08