Lineage for d1pywd2 (1pyw D:122-239)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408294Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 408295Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 408335Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 408336Species Staphylococcus aureus [TaxId:1280] [54345] (7 PDB entries)
  8. 408338Domain d1pywd2: 1pyw D:122-239 [95382]
    Other proteins in same PDB: d1pywa1, d1pywa2, d1pywb1, d1pywb2, d1pywd1
    complexed with ace; mutant

Details for d1pywd2

PDB Entry: 1pyw (more details), 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1pywd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pywd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOP Domain Coordinates for d1pywd2:

Click to download the PDB-style file with coordinates for d1pywd2.
(The format of our PDB-style files is described here.)

Timeline for d1pywd2: