SCOPe 2.04: Domain d1pywa1: 1pyw A:82-182

Lineage for d1pywa1 (1pyw A:82-182)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1pywa1: 1pyw A:82-182 [95377]
   Other proteins in same PDB: d1pywa2, d1pywb1, d1pywb2, d1pywd1, d1pywd2

Details for d1pywa1

PDB Entry: 1pyw, 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1pywa1:

Sequence; same for both SEQRES and ATOM records:

>d1pywa1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1pywa1:

• d1pywa1 first appeared in SCOP 1.67
  
• d1pywa1 appears in SCOPe 2.03
  
• d1pywa1 appears in SCOPe 2.05
  
• d1pywa1 appears in the current release, SCOPe 2.08