Lineage for d1pybd_ (1pyb D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789623Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 2789653Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)
  7. 2789654Species Aquifex aeolicus [TaxId:63363] [101763] (1 PDB entry)
    aq_422; putative methionyl-tRNA synthetase beta subunit
  8. 2789658Domain d1pybd_: 1pyb D: [95333]

Details for d1pybd_

PDB Entry: 1pyb (more details), 2.5 Å

PDB Description: crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
PDB Compounds: (D:) tRNA-binding protein Trbp111

SCOPe Domain Sequences for d1pybd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pybd_ b.40.4.4 (D:) Structure-specific tRNA-binding protein TRBP111 {Aquifex aeolicus [TaxId: 63363]}
aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls

SCOPe Domain Coordinates for d1pybd_:

Click to download the PDB-style file with coordinates for d1pybd_.
(The format of our PDB-style files is described here.)

Timeline for d1pybd_: